As of June 12, 2018 our Privacy Policy has been updated. For individuals in the European Union, CIL uses cookies on this website. Please review the new privacy statement to see how. By continuing to use this website you agree to us using cookies in accordance with our privacy statement. Click here for the new privacy statement..OK

Products
Research Products
Amino Acids Bile Acids Biochemical Pathways Biological Standards Buffers and Reagents Carbohydrates CellFree Protein Expression Cell Growth Media Chemical Tagging Reagents Deuterated Reagents for ElectronicsDeuterated Reagents for PharmaceuticalsElements and Compounds Fatty Acids & Lipids Drug Standards Gases cGMP ProductsGlycans Key Metabolite Standards a-Keto Acids13C Metabolic Probes Metabolomics Mixes and Kits Metabolites & Substrates Methyl Labeling Kits & Amino Acids		 Metabolomics & Cellular 
MetabolismMicrobiological & Pyrogen Tested Mouse Express® Mouse Feed MRI/MRS Products MRM PeptiQuant™ Assay Kits MS/MS StandardsNMR Solvents and ConsumablesNucleic AcidsOrganic Acids & Conjugate Salts Protein StandardsProtein Reagents15N SaltsSILAC ReagentsSpirulinaSteroids and HormonesSynthetic IntermediatesVitaminsWater		 Environmental Contaminant Standards
Cyanotoxin Standards
Dioxin & Furan Individual Standards Dioxin & Furan Method Standards, Standard Mixtures, and Reference Materials PCB Standards & Standard MixturesFlame Retardants Dioxin/Furan Plus PCB Standard Mixtures Polycyclic Aromatic Hydrocarbon (PAH) Standards and Standard Mixtures Priority Pollutant Standard Mixtures Priority Pollutant, Endocrine Disruptor, and Chemical Contaminant Standards
Pesticides, Herbicides, and Metabolites Standards PPCPs Phthalate & Phthalate Metabolite Standards Chemical Weapon Metabolite Standards Per- and Polyfluoroalkyl Substances (PFAS)Stockholm Treaty Compounds

 

New Products

Biomolecular NMR

X-Filtered NOESY NMR Standard (NEX-XF1)

In an X-filtered experiment, only NOEs between 15N/13C-1H and 14N/12C-1H (e.g. interchain NOEs) protons are observed. NOEs between protons connected to 15N,13C are filtered (intrachain NOEs). When uniformly double-labeled protein sample is mixed with a naturalabundance protein sample, the interface will give rise to the only observable NOESY cross peaks. This powerful strategy enables the spectroscopist to discern intra from inter NOESY cross peaks, thereby providing essential distance constraints for defining the dimer interface (Lee, et al., 1994, 350:87; Palmer, et al., 1991, 93:151; Schleucher, et al., 1994, 4:301).

NEX-XF1 is a 16 kDa protein (A. fulgidus antitoxin vapB21 homodimer) for which a set of resonance assignments (bmr7362), 3D structure (2NWT), and other NMR data are available in the public domain. This is a mixture of unlabeled and uniformly 15N,13C-enriched protein (25% homodimer unlabeled; 50% heterodimer unlabeled/labeled; 25% homodimer labeled) and is perfect to set up X-filtered NOESY experiments.

NEX-XF1 homodimer sample formulation:
NEX-XF1: 13C,15N-labeled and unlabeled sample conditions
1 mM protein, 20 mM NH4OAc pH 5.5, 100 mM NaCl, 5 mM CaCl2, 10% D2O, 0.02 % NaN3
 
X-Filtered NOESY NMR Standard 
 
Catalog No. Label
unlabeled
(15N, 95%)
(13C, 5%; 15N, 95%)
(13C, 95%; 15N, 95%)
(13C, 95%; D, 95%; 15N, 95%)
 (13C, 95%; D, 95%; 15N, 95%; 13CH3-ILV)
(13C, 95%; D, 95%; 15N, 95%; 13CH3-ILVFY)
 
X-Filtered NOESY NMR Standard, His-Tagged
 
Catalog No. Label
unlabeled
(15N, 95%)
(13C, 5%; 15N, 95%)
(13C, 95%; 15N, 95%)
NEX-XF1-HIS-CDN
(13C, 95%; D, 95%; 15N, 95%)
(13C, 95%; D, 95%; 15N, 95%; 13CH3-ILV)
(13C, 95%; D, 95%; 15N, 95%; 13CH3-ILVFY)

 

Protein Sequence

PKIIEAVYENGVFKPLQKVDLKEGERVKIKLELKVEPIDLGEPVSVEEIKKIRDGTWMSSLEHHHHHH