Maltose Binding Protein (NEX-MBP)

NEX-MBP is a 44.9 kDa monomeric protein for which multiple sets of resonance assignments (BMRB database) and 3D structures (PDB database) are publicly available. This product is uniformly ²H,¹⁵N,¹³C-enriched with selective incorporation of protons into methyl groups of Ile-δ1, Leu-δ and Val-γ side chains. As nonuniform sampling (NUS) and other NMR techniques emerge to push the size limitations of NMR to new boundaries, large protein standards, such as NEX-MBP, will be required to test data-collection and processing strategies.

NEX-MBP sample formulations:

NEX-MBP1: Apo conformation 0.5 mM 2 H,¹⁵N,¹³C and ILV methyl ¹H,¹³C MBP in 10% D₂O, 0.02% NaN₃ , 20 mM sodium phosphate @ pH 7.2
NEX-MBP2: Closed conformation 0.5 mM 2 H,¹⁵N,¹³C and ILV methyl 1 H,¹³C MBP with 3 mM maltotriose, 10% D₂O, 0.02% NaN₃ , 20 mM sodium phosphate @ pH 7.2
NEX-MBP3: Open conformation 0.5 mM 2 H,¹⁵N,¹³C and ILV methyl 1 H,¹³C MBP with 2 mM β-cyclodextrin, 10% D₂O, 0.02% NaN₃ , 20 mM sodium phosphate @ pH 7.2 

E.coli Maltose Binding Protein (27-396), Apo Conformation

E.coli Maltose Binding Protein (27-396), Closed Conformation

E.coli Maltose Binding Protein (27-396), Open Conformation

Protein Sequence 
MKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAH DRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEE IPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFL VDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKP FVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMEN AQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALKDAQTRITK