As of June 12, 2018 our Privacy Policy has been updated. For individuals in the European Union, CIL uses cookies on this website. Please review the new privacy statement to see how. By continuing to use this website you agree to us using cookies in accordance with our privacy statement. Click here for the new privacy statement..OK

Biomolecular NMR

Maltose Binding Protein (NEX-MBP)

NEX-MBP is a 44.9 kDa monomeric protein for which multiple sets of resonance assignments (BMRB database) and 3D structures (PDB database) are publicly available. This product is uniformly 2H,15N,13C-enriched with selective incorporation of protons into methyl groups of Ile-δ1, Leu-δ and Val-γ side chains. As nonuniform sampling (NUS) and other NMR techniques emerge to push the size limitations of NMR to new boundaries, large protein standards, such as NEX-MBP, will be required to test data-collection and processing strategies.

NEX-MBP sample formulations:

NEX-MBP1: Apo conformation 0.5 mM 2 H,15N,13C and ILV methyl 1H,13C MBP in 10% D2O, 0.02% NaN3 , 20 mM sodium phosphate @ pH 7.2
NEX-MBP2: Closed conformation 0.5 mM 2 H,15N,13C and ILV methyl 1 H,13C MBP with 3 mM maltotriose, 10% D2O, 0.02% NaN3 , 20 mM sodium phosphate @ pH 7.2
NEX-MBP3: Open conformation 0.5 mM 2 H,15N,13C and ILV methyl 1 H,13C MBP with 2 mM β-cyclodextrin, 10% D2O, 0.02% NaN3 , 20 mM sodium phosphate @ pH 7.2 

 

E.coli Maltose Binding Protein (27-396), Apo Conformation

Catalog Label
NEX-MBP1-U unlabeled
NEX-MBP1-N (15N, 95%)
NEX-MBPI-CN-5 (13C, 5%; 15N, 95%)
(13C, 95%; 15N, 95%) 
(13C, 95%; D, 95%; 15N, 95%) 
(13C, 95%; D, 95%; 15N, 95%; 13CH3 -ILV) 
NEX-MBP1-ILVFY (13C, 95%; D, 95%; 15N, 95%; 13CH3 -ILVFY)

 

E.coli Maltose Binding Protein (27-396), Closed Conformation

Catalog No. Label
unlabeled
(15N, 95%)
(13C, 5%; 15N, 95%)
(13C, 95%; 15N, 95%)
(13C, 95%; D, 95%; 15N, 95%)
(13C, 95%; D, 95%; 15N, 95%; 13CH3-ILV)
NEX-MBP2-ILVFY
 (13C, 95%; D, 95%; 15N, 95%; 13CH3-ILVFY)


E.coli Maltose Binding Protein (27-396), Open Conformation

Catalog No. Label
NEX-MBP3-U
unlabeled
(15N, 95%)
NEX-MBP3-CN-5
(13C, 5%; 15N, 95%)
NEX-MBP3-CN
(13C, 95%; 15N, 95%)
NEX-MBP3-CDN
(13C, 95%; D, 95%; 15N, 95%)
(13C, 95%; D, 95%; 15N, 95%; 13CH3-ILV)
(13C, 95%; D, 95%; 15N, 95%; 13CH3-ILVFY)

 

 

 

Protein Sequence 
MKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAH DRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEE IPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFL VDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKP FVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMEN AQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALKDAQTRITK